Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2J4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-14 (12) TLEDSSGTVLHR PA
3
22-29 (8) YGNLTETR PA
3
30-40 (11) TLLAIQQQALR PA
3
41-71 (31) GGAGTGGTGSPQASLEILAPEDSQVLQQATR PA
3
72-93 (22) QEPQGQEHQGGENHLAENTLYR PA
3
101-111 (11) GEELPTYEEAK PA
3
112-131 (20) AHSQYYAAQQAGTRPHAGDR PA
3
162-169 (8) LLQLSLER PA
3
174-189 (16) APSHMSSSHSFPQLAR PA
3
190-197 (8) NQQGPPLR PA
3
198-207 (10) GPPAEGPESR PA
3
208-230 (23) GPPPQYPHVVLAHETTTAVTDPR PA
3
235-245 (11) GSPHFQHAEVR PA
3
246-319 (74) ILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLR PA
3
334-341 (8) ELESSAEK PA
3
355-364 (10) LSEAHESLTR PA
3
409-422 (14) TQEAQAGSQDMVAK PA
3
423-436 (14) LLAQSYEQQQEQEK PA
3
455-468 (14) AELLEQALGNAQGR PA
3
489-502 (14) LQQALGQLQAACEK PA
3
527-547 (21) QAGAPGGSSGSGGSPELSALR PA
2
556-568 (13) EEQILALEADMTK PA
3
581-594 (14) QFAMDAAATAAAQR PA
3
601-621 (21) HSPQPSPSSSFNEGLLTGGHR PA
3
631-639 (9) VLHAQILEK PA
3
657-666 (10) AIQGSLRPAK PA
3
667-690 (24) SVPSVFAAAAAGTQGWQGLSSSER PA
3
691-698 (8) QTADAPAR PA
3
705-721 (17) APTEEPVVTAPPAAHAK PA
3
726-757 (32) DGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQR PA
3
758-768 (11) AASLDSVATSR PA
3
769-780 (12) VQDLSDMVEILI PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center