Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2J4-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-14 (12) TLEDSSGTVLHR PA
3
22-29 (8) YGNLTETR PA
3
30-40 (11) TLLAIQQQALR PA
3
41-71 (31) GGAGTGGTGSPQASLEILAPEDSQVLQQATR PA
3
72-93 (22) QEPQGQEHQGGENHLAENTLYR PA
3
101-111 (11) GEELPTYEEAK PA
3
112-131 (20) AHSQYYAAQQAGTRPHAGDR PA
3
162-169 (8) LLQLSLER PA
3
174-189 (16) APSHMSSSHSFPQLAR PA
3
190-197 (8) NQQGPPLR PA
3
198-207 (10) GPPAEGPESR PA
3
208-230 (23) GPPPQYPHVVLAHETTTAVTDPR PA
3
235-245 (11) GSPHFQHAEVR PA
3
246-319 (74) ILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLR PA
3
334-341 (8) ELESSAEK PA
3
355-364 (10) LSEAHESLTR PA
3
409-422 (14) TQEAQAGSQDMVAK PA
3
423-436 (14) LLAQSYEQQQEQEK PA
3
455-468 (14) AELLEQALGNAQGR PA
3
489-502 (14) LQQALGQLQAACEK PA
3
523-545 (23) AQQAGAPGGSSGSGGSPELSALR PA
0
554-566 (13) EEQILALEADMTK PA
3
579-592 (14) QFAMDAAATAAAQR PA
3
599-619 (21) HSPQPSPSSSFNEGLLTGGHR PA
3
629-637 (9) VLHAQILEK PA
3
655-664 (10) AIQGSLRPAK PA
3
665-688 (24) SVPSVFAAAAAGTQGWQGLSSSER PA
3
689-696 (8) QTADAPAR PA
3
702-718 (17) APTEEPVVTAPPAAHAK PA
3
723-754 (32) DGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQR PA
3
755-765 (11) AASLDSVATSR PA
3
766-777 (12) VQDLSDMVEILI PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center