Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2J4-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-15 (10) ASGGTPCTLR PA
0
17-25 (9) GAPIITLGK PA
0
31-43 (13) LAAGDSVGCSGAR PA
0
61-72 (12) TLEDSSGTVLHR PA
3
80-87 (8) YGNLTETR PA
3
88-98 (11) TLLAIQQQALR PA
3
99-129 (31) GGAGTGGTGSPQASLEILAPEDSQVLQQATR PA
3
130-151 (22) QEPQGQEHQGGENHLAENTLYR PA
3
159-169 (11) GEELPTYEEAK PA
3
170-189 (20) AHSQYYAAQQAGTRPHAGDR PA
3
220-227 (8) LLQLSLER PA
3
232-247 (16) APSHMSSSHSFPQLAR PA
3
248-255 (8) NQQGPPLR PA
3
256-265 (10) GPPAEGPESR PA
3
266-288 (23) GPPPQYPHVVLAHETTTAVTDPR PA
3
293-303 (11) GSPHFQHAEVR PA
3
304-377 (74) ILQAQVPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLR PA
3
392-399 (8) ELESSAEK PA
3
413-422 (10) LSEAHESLTR PA
3
467-480 (14) TQEAQAGSQDMVAK PA
3
481-494 (14) LLAQSYEQQQEQEK PA
3
513-526 (14) AELLEQALGNAQGR PA
3
547-560 (14) LQQALGQLQAACEK PA
3
585-605 (21) QAGAPGGSSGSGGSPELSALR PA
2
614-626 (13) EEQILALEADMTK PA
3
639-652 (14) QFAMDAAATAAAQR PA
3
659-679 (21) HSPQPSPSSSFNEGLLTGGHR PA
3
689-697 (9) VLHAQILEK PA
3
715-724 (10) AIQGSLRPAK PA
3
725-748 (24) SVPSVFAAAAAGTQGWQGLSSSER PA
3
749-756 (8) QTADAPAR PA
3
762-778 (17) APTEEPVVTAPPAAHAK PA
3
783-814 (32) DGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQR PA
3
815-825 (11) AASLDSVATSR PA
3
826-837 (12) VQDLSDMVEILI PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center