Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2K6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-19 (14) DLCPHLDSIGEVTK PA
0
28-68 (41) GTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAK PA
0
70-80 (11) HNLTVNLTTFR PA
0
81-88 (8) LWCYACEK PA
0
96-106 (11) LAAPLLGSSSK PA
0
107-120 (14) FSEQDSPPPSHPLK PA
0
121-142 (22) AVPIAVADEGESESEDDDLKPR PA
0
149-181 (33) NLGNSCYMNAALQALSNCPPLTQFFLECGGLVR PA
0
195-202 (8) LVSEVWHK PA
0
204-218 (15) RPSYVVPTSLSHGIK PA
0
226-237 (12) GYAQQDTQEFLR PA
0
238-248 (11) CLMDQLHEELK PA
0
249-261 (13) EPVVATVALTEAR PA
0
262-271 (10) DSDSSDTDEK PA
0
277-292 (16) SPSEDEFLSCDSSSDR PA
0
293-300 (8) GEGDGQGR PA
0
301-319 (19) GGGSSQAETELLIPDEAGR PA
0
339-370 (32) TNSEQVDEDADVDTAMAALDDQPAEAQPPSPR PA
0
377-387 (11) TPEPDNDAHLR PA
0
388-404 (17) SSSRPCSPVHHHEGHAK PA
0
417-424 (8) MAPSYVLK PA
0
426-434 (9) AQVLSAGSR PA
0
443-464 (22) SVISDIFDGSILSLVQCLTCDR PA
0
465-482 (18) VSTTVETFQDLSLPIPGK PA
0
488-521 (34) LHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIR PA
0
523-553 (31) FVVSCTPSWFWGPVVTLEDCLAAFFAADELK PA
0
554-562 (9) GDNMYSCER PA
0
578-587 (10) LPEILCIHLK PA
0
591-598 (8) HEVMYSFK PA
0
599-618 (20) INSHVSFPLEGLDLRPFLAK PA
0
619-683 (65) ECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYR PA
0
694-703 (10) QQVVSLAAMR PA
0
720-745 (26) FNTFAEPGPITNQTFLCSHGGIPPHK PA
0
746-767 (22) YHYIDDLVVILPQNVWEHLYNR PA
0
768-792 (25) FGGGPAVNHLYVCSICQVEIEALAK PA
0
796-803 (8) IEIDTFIK PA
0
807-826 (20) AFQAEESPGVIYCISMQWFR PA
0
836-847 (12) DNEPPGPIDNSR PA
0
853-860 (8) GSGHVQLK PA
0
861-889 (29) QGADYGQISEETWTYLNSLYGGGPEIAIR PA
0
890-906 (17) QSVAQPLGPENLHGEQK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center