Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2R2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) FLDEAQSK PA
5
22-30 (9) EEFANEFLK PA
5
43-53 (11) TYPTTVAEKPK PA
5
62-70 (9) DILPYDYSR PA
5
71-91 (21) VELSLITSDEDSSYINANFIK PA
5
98-115 (18) AYIATQGPLSTTLLDFWR PA
5
116-136 (21) MIWEYSVLIIVMACMEYEMGK PA
4
142-164 (23) YWAEPGEMQLEFGPFSVSCEAEK PA
3
184-191 (8) TIYQFHYK PA
3
192-213 (22) NWPDHDVPSSIDPILELIWDVR PA
3
214-233 (20) CYQEDDSVPICIHCSAGCGR PA
3
234-248 (15) TGVICAIDYTWMLLK PA
3
249-263 (15) DGIIPENFSVFSLIR PA
2
267-291 (25) TQRPSLVQTQEQYELVYNAVLELFK PA
3
301-309 (9) HSGTESQAK PA
3
316-330 (15) NHTLQADSYSPNLPK PA
4
350-357 (8) ESSSFDFR PA
4
365-373 (9) EELVLHPAK PA
4
374-389 (16) SSTSFDFLELNYSFDK PA
4
401-411 (11) AFPIVGEPLQK PA
4
412-436 (25) HQSLDLGSLLFEGCSNSKPVNAAGR PA
4
449-458 (10) STPFELIQQR PA
4
467-488 (22) ENFSYLESQPHDSCFVEMQAQK PA
4
489-506 (18) VMHVSSAELNYSLPYDSK PA
4
517-548 (32) HHDSSALGVYSYIPLVENPYFSSWPPSGTSSK PA
4
549-556 (8) MSLDLPEK PA
4
557-608 (52) QDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPR PA
4
609-620 (12) IDDEIPPPLPVR PA
4
621-640 (20) TPESFIVVEEAGEFSPNVPK PA
4
650-663 (14) IGTSLEWGGTSEPK PA
3
665-675 (11) FDDSVILRPSK PA
3
691-700 (10) SSPPPPLPER PA
3
701-736 (36) TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSK PA
3
761-791 (31) SICNSCPPNKPAESVQSNNSSSFLNFGFANR PA
2
800-807 (8) NPPPTWNI PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center