Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2R2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) FLDEAQSK PA
5
22-30 (9) EEFANEFLK PA
5
43-53 (11) TYPTTVAEKPK PA
5
62-70 (9) DILPYDYSR PA
5
71-91 (21) VELSLITSDEDSSYINANFIK PA
5
98-115 (18) AYIATQGPLSTTLLDFWR PA
5
116-136 (21) MIWEYSVLIIVMACMEYEMGK PA
4
142-164 (23) YWAEPGEMQLEFGPFSVSCEAEK PA
3
184-191 (8) TIYQFHYK PA
3
192-213 (22) NWPDHDVPSSIDPILELIWDVR PA
3
214-233 (20) CYQEDDSVPICIHCSAGCGR PA
3
234-248 (15) TGVICAIDYTWMLLK PA
3
261-275 (15) NHTLQADSYSPNLPK PA
4
295-302 (8) ESSSFDFR PA
4
310-318 (9) EELVLHPAK PA
4
319-334 (16) SSTSFDFLELNYSFDK PA
4
346-356 (11) AFPIVGEPLQK PA
4
357-381 (25) HQSLDLGSLLFEGCSNSKPVNAAGR PA
4
394-403 (10) STPFELIQQR PA
4
412-433 (22) ENFSYLESQPHDSCFVEMQAQK PA
4
434-451 (18) VMHVSSAELNYSLPYDSK PA
4
462-493 (32) HHDSSALGVYSYIPLVENPYFSSWPPSGTSSK PA
4
494-501 (8) MSLDLPEK PA
4
502-553 (52) QDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPR PA
4
554-565 (12) IDDEIPPPLPVR PA
4
566-585 (20) TPESFIVVEEAGEFSPNVPK PA
4
595-608 (14) IGTSLEWGGTSEPK PA
3
610-620 (11) FDDSVILRPSK PA
3
636-645 (10) SSPPPPLPER PA
3
646-681 (36) TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSK PA
3
706-736 (31) SICNSCPPNKPAESVQSNNSSSFLNFGFANR PA
2
745-752 (8) NPPPTWNI PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center