Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y2R2-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) FLDEAQSK PA
5
22-30 (9) EEFANEFLK PA
5
43-53 (11) TYPTTVAEKPK PA
5
62-70 (9) DILPYDYSR PA
5
71-91 (21) VELSLITSDEDSSYINANFIK PA
5
98-115 (18) AYIATQGPLSTTLLDFWR PA
5
116-136 (21) MIWEYSVLIIPENFSVFSLIR PA
0
140-164 (25) TQRPSLVQTQEQYELVYNAVLELFK PA
3
174-182 (9) HSGTESQAK PA
3
189-203 (15) NHTLQADSYSPNLPK PA
4
223-230 (8) ESSSFDFR PA
4
238-246 (9) EELVLHPAK PA
4
247-262 (16) SSTSFDFLELNYSFDK PA
4
274-284 (11) AFPIVGEPLQK PA
4
285-309 (25) HQSLDLGSLLFEGCSNSKPVNAAGR PA
4
322-331 (10) STPFELIQQR PA
4
340-361 (22) ENFSYLESQPHDSCFVEMQAQK PA
4
362-379 (18) VMHVSSAELNYSLPYDSK PA
4
390-421 (32) HHDSSALGVYSYIPLVENPYFSSWPPSGTSSK PA
4
422-429 (8) MSLDLPEK PA
4
430-481 (52) QDGTVFPSSLLPTSSTSLFSYYNSHDSLSLNSPTNISSLLNQESAVLATAPR PA
4
482-493 (12) IDDEIPPPLPVR PA
4
494-513 (20) TPESFIVVEEAGEFSPNVPK PA
4
523-536 (14) IGTSLEWGGTSEPK PA
3
538-548 (11) FDDSVILRPSK PA
3
564-573 (10) SSPPPPLPER PA
3
574-609 (36) TLESFFLADEDCMQAQSIETYSTSYPDTMENSTSSK PA
3
634-667 (34) SICNSCPPNKPAESVQSNNSSSFLNFGMCVILLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center