Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4E6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MAGNSLVLPIVLWGR PA
1
17-57 (41) APTHCISAVLLTDDGATIVTGCHDGQICLWDLSVELQINPR PA
1
58-72 (15) ALLFGHTASITCLSK PA
1
80-100 (21) QYIVSASESGEMCLWDVSDGR PA
1
107-125 (19) LACTHTGIQFYQFSVGNQR PA
1
129-155 (27) LLCHGHYPEILVVDATSLEVLYSLVSK PA
1
156-168 (13) ISPDWISSMSIIR PA
1
172-187 (16) TQEDTVVALSVTGILK PA
1
188-228 (41) VWIVTSEISDMQDTEPIFEEESKPIYCQNCQSISFCAFTQR PA
1
229-236 (8) SLLVVCSK PA
1
240-270 (31) VFDAGDYSLLCSGPSENGQTWTGGDFVSSDK PA
1
271-284 (14) VIIWTENGQSYIYK PA
1
285-297 (13) LPASCLPASDSFR PA
1
303-318 (16) AVENLIPPVQHILLDR PA
1
322-331 (10) ELLICPPVTR PA
1
343-352 (10) LLIQGDSSGR PA
1
353-364 (12) LNIWNISDTADK PA
1
365-385 (21) QGSEEGLAMTTSISLQEAFDK PA
1
386-408 (23) LNPCPAGIIDQLSVIPNSNEPLK PA
1
409-420 (12) VTASVYIPAHGR PA
1
426-451 (26) EDGSIVIVPATQTAIVQLLQGEHMLR PA
1
467-479 (13) VTCLLYPHQVSAR PA
1
484-505 (22) YLISGGVDFSVIIWDIFSGEMK PA
1
506-528 (23) HIFCVHGGEITQLLVPPENCSAR PA
1
529-548 (20) VQHCICSVASDHSVGLLSLR PA
1
559-567 (9) HLFPIQVIK PA
1
568-596 (29) WRPSDDYLVVGCSDGSVYVWQMDTGALDR PA
1
597-629 (33) CVMGITAVEILNACDEAVPAAVDSLSHPAVNLK PA
1
648-663 (16) LQTLATNLLASEASDK PA
1
669-680 (12) YSHNSLMVQAIK PA
1
681-722 (42) TNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENLQK PA
1
730-737 (8) GGSFLTGK PA
1
739-747 (9) AAVLFQQVK PA
1
756-770 (15) EHLLDDEEEDEEIMR PA
1
774-781 (8) EESDPEYR PA
1
785-801 (17) SKPLTLLEYNLTMDTAK PA
1
802-823 (22) LFMSCLHAWGLNEVLDEVCLDR PA
1
824-840 (17) LGMLKPHCTVSFGLLSR PA
1
841-857 (17) GGHMSLMLPGYNQPACK PA
1
869-877 (9) LPASEGVGK PA
1
885-915 (31) AVTTQHLLSIISLANTLMSMTNATFIGDHMK PA
1
917-931 (15) GPTRPPRPSTPDLSK PA
1
934-948 (15) GSPPTSSNIVQGQIK PA
1
949-970 (22) QGWSQLAAMHCVMLPDLLGLDK PA
0
971-981 (11) FRPPLLEMLAR PA
1
992-1003 (12) EAAQALLLAELR PA
1
1012-1053 (42) EAIDAWAPYLPQYIDHVISPGVTSEAAQTITTAPDASGPEAK PA
1
1054-1078 (25) VQEEEHDLVDDDITTGCLSSVPQMK PA
1
1080-1087 (8) ISTSYEER PA
1
1090-1112 (23) QATAIVLLGVIGAEFGAEIEPPK PA
1
1119-1140 (22) SSSQIPEGFGLTSGGSNYSLAR PA
1
1145-1157 (13) ALTFLLLQPPSPK PA
1
1158-1165 (8) LPPHSTIR PA
1
1167-1174 (8) TAIDLIGR PA
1
1175-1201 (27) GFTVWEPYMDVSAVLMGLLELCADAEK PA
1
1202-1220 (19) QLANITMGLPLSPAADSAR PA
1
1224-1243 (20) HALSLIATARPPAFITTIAK PA
1
1248-1268 (21) HTALAANTQSQQNMHTTTLAR PA
1
1276-1283 (8) VIEILIEK PA
1
1284-1309 (26) MPTDVVDLLVEVMDIIMYCLEGSLVK PA
1
1312-1322 (11) GLQECFPAICR PA
1
1323-1331 (9) FYMVSYYER PA
1
1341-1350 (10) HGSVALYDIR PA
1
1354-1361 (8) CQTIHGHK PA
1
1362-1374 (13) GPITAVAFAPDGR PA
1
1375-1409 (35) YLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLR PA
1
1413-1431 (19) TYQVPPVQPASPGSHNALK PA
1
1442-1451 (10) NVILMAHDGK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center