Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
48-63 (16) CNLHLVDIWNVIEALR PA
11
64-80 (17) ENALNNLDPNTELNVSR PA
11
81-94 (14) LEAVLSTIFYQLNK PA
11
96-126 (31) MPTTHQIHVEQSISLLLNFLLAAFDPEGHGK PA
11
134-143 (10) MALATLCGGK PA
11
150-166 (17) YIFSMISDSSGVMVYGR PA
11
177-195 (19) LPTAVFEGPSFGYTEQSAR PA
11
204-230 (27) VTLNGFLDTLMSDPPPQCLVWLPLLHR PA
10
231-255 (25) LANVENVFHPVECSYCHSESMMGFR PA
10
258-273 (16) CQQCHNYQLCQDCFWR PA
10
274-287 (14) GHAGGSHSNQHQMK PA
10
306-313 (8) SLSCASSR PA
10
314-364 (51) EPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLFSHSVPSSGSPFITR PA
4
370-377 (8) DSEVEQNK PA
4
391-401 (11) GIQYSLNVADR PA
3
402-417 (16) LADEHVLIGLYVNMLR PA
3
418-429 (12) NNPSCMLESSNR PA
3
444-457 (14) LAAESSSSQPPQQR PA
12
458-470 (13) SAPDISFTIDANK PA
13
474-482 (9) QLIAELENK PA
20
485-492 (8) EILQEIQR PA
20
495-507 (13) LEHEQASQPTPEK PA
20
508-519 (12) AQQNPTLLAELR PA
20
532-539 (8) MSALQESR PA
20
541-551 (11) ELMVQLEGLMK PA
13
555-562 (8) TQGAGSPR PA
6
563-578 (16) SSPSHTISRPIPMPIR PA
7
579-610 (32) SASACSTPTHTPQDSLTGVGGDVQEAFAQSSR PA
7
615-633 (19) NDLLVAADSITNTMSSLVK PA
10
634-653 (20) ELNSEVGSETESNVDSEFAR PA
7
654-667 (14) TQFEDLVPSPTSEK PA
7
668-676 (9) AFLAQIHAR PA
7
677-691 (15) KPGYIHSGATTSTMR PA
7
692-716 (25) GDMVTEDADPYVQPEDENYENDSVR PA
7
717-729 (13) QLENELQMEEYLK PA
7
732-743 (12) LQDEAYQVSLQG PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center