Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-10)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-43 (43) MFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITR PA
3
45-63 (19) LPEGISASSPVAEEHSLIK PA
1
64-74 (11) LYVNQLDHGAR PA
1
96-109 (14) LAAESSSSQPPQQR PA
12
110-122 (13) SAPDISFTIDANK PA
13
126-134 (9) QLIAELENK PA
20
137-144 (8) EILQEIQR PA
20
147-159 (13) LEHEQASQPTPEK PA
20
160-171 (12) AQQNPTLLAELR PA
20
184-191 (8) MSALQESR PA
20
193-203 (11) ELMVQLEGLMK PA
13
207-214 (8) TQGAGSPR PA
6
215-230 (16) SSPSHTISRPIPMPIR PA
7
231-262 (32) SASACSTPTHTPQDSLTGVGGDVQEAFAQSSR PA
7
267-285 (19) NDLLVAADSITNTMSSLVK PA
10
286-305 (20) ELNSEVGSETESNVDSEFAR PA
7
306-319 (14) TQFEDLVPSPTSEK PA
7
320-328 (9) AFLAQIHAR PA
7
329-343 (15) KPGYIHSGATTSTMR PA
7
344-368 (25) GDMVTEDADPYVQPEDENYENDSVR PA
7
369-381 (13) QLENELQMEEYLK PA
7
384-395 (12) LQDEAYQVSLQG PA
6
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center