Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-12)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
48-63 (16) CNLHLVDIWNVIEALR PA
11
64-80 (17) ENALNNLDPNTELNVSR PA
11
81-94 (14) LEAVLSTIFYQLNK PA
11
96-126 (31) MPTTHQIHVEQSISLLLNFLLAAFDPEGHGK PA
11
134-143 (10) MALATLCGGK PA
11
150-166 (17) YIFSMISDSSGVMVYGR PA
11
177-195 (19) LPTAVFEGPSFGYTEQSAR PA
11
196-207 (12) SCFSQQQPPQQR PA
0
208-220 (13) SAPDISFTIDANK PA
13
224-232 (9) QLIAELENK PA
20
235-242 (8) EILQEIQR PA
20
245-257 (13) LEHEQASQPTPEK PA
20
258-269 (12) AQQNPTLLAELR PA
20
282-289 (8) MSALQESR PA
20
291-301 (11) ELMVQLEGLMK PA
13
310-319 (10) QGVSYVPYCR PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center