Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-15)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
48-63 (16) CNLHLVDIWNVIEALR PA
11
64-80 (17) ENALNNLDPNTELNVSR PA
11
81-94 (14) LEAVLSTIFYQLNK PA
11
96-126 (31) MPTTHQIHVEQSISLLLNFLLAAFDPEGHGK PA
11
134-143 (10) MALATLCGGK PA
11
150-166 (17) YIFSMISDSSGVMVYGR PA
11
177-195 (19) LPTAVFEGPSFGYTEQSAR PA
11
204-230 (27) VTLNGFLDTLMSDPPPQCLVWLPLLHR PA
10
231-255 (25) LANVENVFHPVECSYCHSESMMGFR PA
10
258-273 (16) CQQCHNYQLCQDCFWR PA
10
274-287 (14) GHAGGSHSNQHQMK PA
10
306-313 (8) SLSCASSR PA
10
314-361 (48) EPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITR PA
5
362-369 (8) SMLESSNR PA
6
384-397 (14) LAAESSSSQPPQQR PA
12
398-410 (13) SAPDISFTIDANK PA
13
414-422 (9) QLIAELENK PA
20
425-432 (8) EILQEIQR PA
20
435-447 (13) LEHEQASQPTPEK PA
20
448-459 (12) AQQNPTLLAELR PA
20
472-479 (8) MSALQESR PA
20
481-491 (11) ELMVQLEGLMK PA
13
495-502 (8) TQGAGSPR PA
6
503-518 (16) SSPSHTISRPIPMPIR PA
7
519-550 (32) SASACSTPTHTPQDSLTGVGGDVQEAFAQSSR PA
7
555-573 (19) NDLLVAADSITNTMSSLVK PA
10
574-593 (20) ELNSEVGSETESNVDSEFAR PA
7
594-607 (14) TQFEDLVPSPTSEK PA
7
608-616 (9) AFLAQIHAR PA
7
617-631 (15) KPGYIHSGATTSTMR PA
7
632-656 (25) GDMVTEDADPYVQPEDENYENDSVR PA
7
657-669 (13) QLENELQMEEYLK PA
7
672-686 (15) LQDEAYQLHVSTETR PA
0
687-697 (11) LEHPCPVSETK PA
0
700-724 (25) VLFWGFVFFGGFLSLALQIYFWGLF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center