Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
48-63 (16) CNLHLVDIWNVIEALR PA
11
64-80 (17) ENALNNLDPNTELNVSR PA
11
81-94 (14) LEAVLSTIFYQLNK PA
11
96-126 (31) MPTTHQIHVEQSISLLLNFLLAAFDPEGHGK PA
11
134-143 (10) MALATLCGGK PA
11
150-166 (17) YIFSMISDSSGVMVYGR PA
11
177-195 (19) LPTAVFEGPSFGYTEQSAR PA
11
204-230 (27) VTLNGFLDTLMSDPPPQCLVWLPLLHR PA
10
231-255 (25) LANVENVFHPVECSYCHSESMMGFR PA
10
258-273 (16) CQQCHNYQLCQDCFWR PA
10
274-287 (14) GHAGGSHSNQHQMK PA
10
306-313 (8) SLSCASSR PA
10
314-361 (48) EPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITR PA
5
367-374 (8) DSEVEQNK PA
4
388-398 (11) GIQYSLNVADR PA
3
399-414 (16) LADEHVLIGLYVNMLR PA
3
415-426 (12) NNPSCMLESSNR PA
3
441-454 (14) LAAESSSSQPPQQR PA
12
455-467 (13) SAPDISFTIDANK PA
13
471-479 (9) QLIAELENK PA
20
482-489 (8) EILQEIQR PA
20
492-504 (13) LEHEQASQPTPEK PA
20
505-516 (12) AQQNPTLLAELR PA
20
529-536 (8) MSALQESR PA
20
538-548 (11) ELMVQLEGLMK PA
13
557-566 (10) QGVSYVPYCR PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center