Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y4J8-8)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-43 (43) MFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITR PA
3
44-51 (8) SMLESSNR PA
6
66-79 (14) LAAESSSSQPPQQR PA
12
80-92 (13) SAPDISFTIDANK PA
13
96-104 (9) QLIAELENK PA
20
107-114 (8) EILQEIQR PA
20
117-129 (13) LEHEQASQPTPEK PA
20
130-141 (12) AQQNPTLLAELR PA
20
154-161 (8) MSALQESR PA
20
163-173 (11) ELMVQLEGLMK PA
13
182-191 (10) QGVSYVPYCR PA
5
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center