Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y574-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MDGTTAPVTK PA
1
41-61 (21) QIDVDTVFEVEDENMVLASYK PA
1
62-70 (9) QGYWLPSYK PA
1
73-108 (36) SSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGK PA
1
109-124 (16) TPLHVACEMANVDCVK PA
1
133-157 (25) LNCYSLSGHTALHFCTTPSSILCAK PA
1
170-221 (52) TNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALR PA
1
224-236 (13) EQEYSTEHHLVCR PA
1
259-294 (36) AAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLK PA
1
295-318 (24) VTSVRPAAQPEICYQLLLNHGAAR PA
1
319-326 (8) IYPPQFHK PA
1
339-349 (11) IQMAALSEISK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center