Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y5E9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-28 (28) MESAQDLDVGSNSLQNYTISPNSHFYIK PA
0
37-45 (9) IYPELVLDR PA
1
46-56 (11) ALDYEQEAELR PA
1
57-69 (13) LTLTAVDGGSPPK PA
1
70-78 (9) SGTTLVLIK PA
1
79-114 (36) VLDINDNAPEFPQSLYEVQVPEDRPLGSWIATISAK PA
1
115-123 (9) DLDAGNYGK PA
1
124-136 (13) ISYTFFHASEDIR PA
1
138-151 (14) TFEINPISGEVNLR PA
1
152-177 (26) SPLDFEVIQSYTINIQATDGGGLSGK PA
1
184-201 (18) VMDINDNPPEVTISSITK PA
1
203-227 (25) IPENASETLVALFSILDQDSGDNGR PA
1
228-245 (18) MICSIQDNLPFFLKPTFK PA
1
246-254 (9) NFFTLVSEK PA
1
259-277 (19) ESQAEYNITITVTDLGTPR PA
1
280-308 (29) TEYNITVLLSDVNDNAPTFTQTSYTLFVR PA
1
309-325 (17) ENNSPALHIGSVSATDR PA
13
326-343 (18) DSGTNAQVNYSLLPPQDR PA
1
344-364 (21) HLPLASLVSINADNGHLFALR PA
1
365-377 (13) SLDYEALQEFEFR PA
1
384-395 (12) GSPALSSEALVR PA
12
396-425 (30) VLVLDANDNSPFVLYPLQNGSAPCTELVPR PA
11
426-435 (10) AAEPGYLVTK PA
21
436-455 (20) VVAVDGDSGQNAWLSYQLLK PA
17
456-472 (17) ATEPGLFGVWAHNGEVR PA
14
500-559 (60) SATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSLFLFSVLLFVAVR PA
6
572-612 (41) CSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSGTNEFK PA
1
613-628 (16) FLKPIIPNFQVHDTGR PA
1
629-637 (9) NMGEIENFR PA
1
638-645 (8) NSFGLNIQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center