Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y5R2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-25 (17) AAPGPPPPPPPPGQAPR PA
0
35-51 (17) LLLLLLPALCCLPGAAR PA
0
52-62 (11) AAAAAAGAGNR PA
0
63-71 (9) AAVAVAVAR PA
0
72-86 (15) ADEAEAPFAGQNWLK PA
0
87-97 (11) SYGYLLPYDSR PA
0
98-105 (8) ASALHSAK PA
0
106-135 (30) ALQSAVSTMQQFYGIPVTGVLDQTTIEWMK PA
0
139-149 (11) CGVPDHPHLSR PA
0
167-178 (12) HITYSIHNYTPK PA
0
190-197 (8) QAFDVWQK PA
0
198-212 (15) VTPLTFEEVPYHEIK PA
0
217-313 (97) EADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFK PA
0
314-324 (11) LPQDDLQGIQK PA
0
325-345 (21) IYGPPAEPLEPTRPLPTLPVR PA
0
358-391 (34) QPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFR PA
0
410-423 (14) VQEGYPMQIEQFWK PA
0
453-473 (21) EVTVEPGYPHSLGELGSCLPR PA
0
474-481 (8) EGIDTALR PA
0
505-518 (14) ATDPGYPKPITVWK PA
0
519-531 (13) GIPQAPQGAFISK PA
0
532-540 (9) EGYYTYFYK PA
0
552-560 (9) LSVEPGYPR PA
0
565-572 (8) DWMGCNQK PA
0
582-626 (45) LPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFK PA
0
629-638 (10) TGPQPVTYYK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center