Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y5R4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-17 (11) MLWALLSGPGR PA
0
23-54 (32) GWAFSSWQPQPPLAGLSSAIELVSHWTGVFEK PA
0
62-75 (14) ESSEYIVAHVLGAK PA
0
76-98 (23) TFQSLRPALWTQPLTSQQLQCIR PA
0
108-125 (18) MPVQYILGEWDFQGLSLR PA
0
126-151 (26) MVPPVFIPRPETEELVEWVLEEVAQR PA
0
152-185 (34) SHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSR PA
0
193-205 (13) EAAISLTHENAQR PA
0
212-223 (12) IWIIHLDMTSER PA
0
224-256 (33) SWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIR PA
0
257-283 (27) SYEDPAALDGGEEGMDIITHILALAPR PA
0
287-298 (12) DSGSIFLEVDPR PA
0
299-321 (23) HPELVSSWLQSRPDLYLNLVAVR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center