Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_Q9Y5X1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-43 (37) VMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGR PA
0
50-65 (16) GLVPTDYVEILPSDGK PA
0
66-115 (50) DQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASK PA
0
116-136 (21) SGNWESSEGWGAQPEGAGAQR PA
0
137-173 (37) NTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPK PA
0
180-191 (12) DSESADAGGAQR PA
0
208-223 (16) FPGFAKPGTEQYLLAK PA
0
232-258 (27) IPIIVGDYGPMWVYPTSTFDCVVADPR PA
0
268-281 (14) SYIEYQLTPTNTNR PA
0
289-296 (8) HFDWLYER PA
0
301-313 (13) FGSAIPIPSLPDK PA
0
341-357 (17) HPVISESEVFQQFLNFR PA
0
372-398 (27) DELAGVMIFSTMEPEAPDLDLVEIEQK PA
0
415-425 (11) ELLTVGQEHWK PA
0
441-469 (29) ALQSLATVFSSSGYQGETDLNDAITEAGK PA
0
470-483 (14) TYEEIASLVAEQPK PA
0
485-497 (13) DLHFLMECNHEYK PA
0
498-511 (14) GFLGCFPDIIGTHK PA
0
541-559 (19) VSIMSYALQAEMNHFHSNR PA
0
560-568 (9) IYDYNSVIR PA
0
569-584 (16) LYLEQQVQFYETIAEK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center